Recombinant Full Length Human PDE1A Protein, C-Flag-tagged
Cat.No. : | PDE1A-779HFL |
Product Overview : | Recombinant Full Length Human PDE1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Cyclic nucleotide phosphodiesterases (PDEs) play a role in signal transduction by regulating intracellular cyclic nucleotide concentrations through hydrolysis of cAMP and/or cGMP to their respective nucleoside 5-prime monophosphates. Members of the PDE1 family, such as PDE1A, are Ca(2+)/calmodulin (see CALM1; MIM 114180)-dependent PDEs (CaM-PDEs) that are activated by calmodulin in the presence of Ca(2+). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62.1 kDa |
AA Sequence : | MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAASVLEAVYIDE TRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRSIVHAVQAGIFVERMYRKTYH MVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIPVSCLITFAEALEVG YSKYKNPYHNLIHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAI LYNDRSVLENHHVSAAYRLMQEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPE GIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGSMSDGSYSPDY SLAAVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDETHSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Calcium signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism, Taste transduction |
Full Length : | Full L. |
Gene Name | PDE1A phosphodiesterase 1A [ Homo sapiens (human) ] |
Official Symbol | PDE1A |
Synonyms | HCAM1; HCAM-1; HSPDE1A; CAM-PDE 1A; CAM-PDE-1A |
Gene ID | 5136 |
mRNA Refseq | NM_005019.7 |
Protein Refseq | NP_005010.2 |
MIM | 171890 |
UniProt ID | P54750 |
◆ Recombinant Proteins | ||
PDE1A-29692TH | Recombinant Human PDE1A | +Inquiry |
PDE1A-471H | Recombinant Human PDE1A, His-tagged, Active | +Inquiry |
PDE1A-333H | Recombinant Human PDE1A | +Inquiry |
PDE1A-1787H | Recombinant Human PDE1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDE1A-300H | Recombinant Human PDE1A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE1A-3353HCL | Recombinant Human PDE1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDE1A Products
Required fields are marked with *
My Review for All PDE1A Products
Required fields are marked with *
0
Inquiry Basket