Recombinant Full Length Human PDE6D Protein, C-Flag-tagged
Cat.No. : | PDE6D-480HFL |
Product Overview : | Recombinant Full Length Human PDE6D Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the delta subunit of rod-specific photoreceptor phosphodiesterase (PDE), a key enzyme in the phototransduction cascade. A similar protein in cow functions in solubilizing membrane-bound PDE. In addition to its role in the PDE complex, the encoded protein is thought to bind to prenyl groups of proteins to target them to subcellular organelles called cilia. Mutations in this gene are associated with Joubert syndrome-22. Alternative splicing results in multiple splice variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.2 kDa |
AA Sequence : | MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV STSRVRLFYVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Progesterone-mediated oocyte maturation, Purine metabolism |
Full Length : | Full L. |
Gene Name | PDE6D phosphodiesterase 6D [ Homo sapiens (human) ] |
Official Symbol | PDE6D |
Synonyms | PDED; JBTS22 |
Gene ID | 5147 |
mRNA Refseq | NM_002601.4 |
Protein Refseq | NP_002592.1 |
MIM | 602676 |
UniProt ID | O43924 |
◆ Recombinant Proteins | ||
PDE6D-301348H | Recombinant Human PDE6D Full length protein, His-tagged | +Inquiry |
PDE6D-6590M | Recombinant Mouse PDE6D Protein, His (Fc)-Avi-tagged | +Inquiry |
PDE6D-29160TH | Recombinant Human PDE6D, His-tagged | +Inquiry |
Pde6d-4749M | Recombinant Mouse Pde6d Protein, Myc/DDK-tagged | +Inquiry |
PDE6D-2407H | Recombinant Human PDE6D, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE6D-3345HCL | Recombinant Human PDE6D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDE6D Products
Required fields are marked with *
My Review for All PDE6D Products
Required fields are marked with *
0
Inquiry Basket