Recombinant Full Length Human PDIA3 Protein, C-Flag-tagged

Cat.No. : PDIA3-871HFL
Product Overview : Recombinant Full Length Human PDIA3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. This protein also functions as a molecular chaperone that prevents the formation of protein aggregates.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 54.2 kDa
AA Sequence : MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAA ATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR TEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSH LTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE RFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVI
QEEKPKKKKKAQEDLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Antigen processing and presentation
Full Length : Full L.
Gene Name PDIA3 protein disulfide isomerase family A member 3 [ Homo sapiens (human) ]
Official Symbol PDIA3
Synonyms P58; ER60; ERp57; ERp60; ERp61; GRP57; GRP58; PI-PLC; HsT17083; HEL-S-269; HEL-S-93n
Gene ID 2923
mRNA Refseq NM_005313.5
Protein Refseq NP_005304.3
MIM 602046
UniProt ID P30101

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDIA3 Products

Required fields are marked with *

My Review for All PDIA3 Products

Required fields are marked with *

0
cart-icon
0
compare icon