Recombinant Full Length Human PDX1 Protein

• Cat.No.: PDX1-367HF
• Product Overview: Recombinant full length protein of Human PDX1 with proprietary tag; predicted MW 58.13 kDa, inclusive of tag.

Specification

• Description: The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 58.130kDa inclusive of tags
• Protein Length: 283 amino acids
• AA Sequence: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGR QPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVA HLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLE LEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK WKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ EPR
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ]
• Official Symbol: PDX1
• Synonyms: PDX1; pancreatic and duodenal homeobox 1; insulin promoter factor 1, homeodomain transcription factor , IPF1; pancreas/duodenum homeobox protein 1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1
• Gene ID: 3651
• mRNA Refseq: NM_000209
• Protein Refseq: NP_000200
• MIM: 600733
• UniProt ID: P52945