Recombinant Full Length Human PDX1 Protein
| Cat.No. : | PDX1-367HF |
| Product Overview : | Recombinant full length protein of Human PDX1 with proprietary tag; predicted MW 58.13 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 283 amino acids |
| Description : | The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). |
| Form : | Liquid |
| Molecular Mass : | 58.130kDa inclusive of tags |
| AA Sequence : | MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGR QPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVA HLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLE LEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK WKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ EPR |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ] |
| Official Symbol | PDX1 |
| Synonyms | PDX1; pancreatic and duodenal homeobox 1; insulin promoter factor 1, homeodomain transcription factor , IPF1; pancreas/duodenum homeobox protein 1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1 |
| Gene ID | 3651 |
| mRNA Refseq | NM_000209 |
| Protein Refseq | NP_000200 |
| MIM | 600733 |
| UniProt ID | P52945 |
| ◆ Recombinant Proteins | ||
| PDX1-1642H | Recombinant Human PDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Pdx1-2749R | Recombinant Rat Pdx1 Protein, His&GST-tagged | +Inquiry |
| PDX1-1923HFL | Recombinant Full Length Human PDX1 Protein, C-Flag-tagged | +Inquiry |
| PDX1-12601M | Recombinant Mouse PDX1 Protein | +Inquiry |
| PDX1-29672TH | Recombinant Human PDX1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDX1-3318HCL | Recombinant Human PDX1 293 Cell Lysate | +Inquiry |
| PDX1-266HKCL | Human PDX1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDX1 Products
Required fields are marked with *
My Review for All PDX1 Products
Required fields are marked with *
