Recombinant Full Length Human PEA15 Protein, C-Flag-tagged
Cat.No. : | PEA15-2194HFL |
Product Overview : | Recombinant Full Length Human PEA15 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS RRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PEA15 proliferation and apoptosis adaptor protein 15 [ Homo sapiens (human) ] |
Official Symbol | PEA15 |
Synonyms | PED; MAT1; HMAT1; MAT1H; PEA-15; HUMMAT1H; PED-PEA15; PED/PEA15 |
Gene ID | 8682 |
mRNA Refseq | NM_003768.5 |
Protein Refseq | NP_003759.1 |
MIM | 603434 |
UniProt ID | Q15121 |
◆ Recombinant Proteins | ||
PEA15-30834TH | Recombinant Human PEA15 | +Inquiry |
PEA15-3185R | Recombinant Rhesus Macaque PEA15 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEA15-2194HFL | Recombinant Full Length Human PEA15 Protein, C-Flag-tagged | +Inquiry |
PEA15-1643H | Recombinant Human PEA15 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEA15-30833TH | Recombinant Human PEA15 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEA15-3312HCL | Recombinant Human PEA15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PEA15 Products
Required fields are marked with *
My Review for All PEA15 Products
Required fields are marked with *