Recombinant Full Length Human PEA15 Protein, C-Flag-tagged

• Cat.No.: PEA15-2194HFL
• Product Overview: Recombinant Full Length Human PEA15 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 14.9 kDa
• AA Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS RRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Full Length: Full L.

Gene Information

• Gene Name: PEA15 proliferation and apoptosis adaptor protein 15 [ Homo sapiens (human) ]
• Official Symbol: PEA15
• Synonyms: PED; MAT1; HMAT1; MAT1H; PEA-15; HUMMAT1H; PED-PEA15; PED/PEA15
• Gene ID: 8682
• mRNA Refseq: NM_003768.5
• Protein Refseq: NP_003759.1
• MIM: 603434
• UniProt ID: Q15121