Recombinant Human PEA15 protein, GST-tagged

Cat.No. : PEA15-4418H
Product Overview : Recombinant Human PEA15 protein(Q15121)(1-130aa), fused to N-terminal GST tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-130aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42 kDa
AA Sequence : MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PEA15 phosphoprotein enriched in astrocytes 15 [ Homo sapiens ]
Official Symbol PEA15
Synonyms PEA15; phosphoprotein enriched in astrocytes 15; astrocytic phosphoprotein PEA-15; HMAT1; homolog of mouse MAT 1 oncogene; HUMMAT1H; MAT1; MAT1H; PEA 15; PED; Phosphoprotein enriched in astrocytes; 15kD; homolog of mouse MAT-1 oncogene; phosphoprotein enriched in diabetes; Phosphoprotein enriched in astrocytes, 15kD; 15 kDa phosphoprotein enriched in astrocytes; PEA-15;
Gene ID 8682
mRNA Refseq NM_003768
Protein Refseq NP_003759
MIM 603434
UniProt ID Q15121

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PEA15 Products

Required fields are marked with *

My Review for All PEA15 Products

Required fields are marked with *

0
cart-icon