Recombinant Human PEA15 protein, GST-tagged

• Cat.No.: PEA15-4418H
• Product Overview: Recombinant Human PEA15 protein(Q15121)(1-130aa), fused to N-terminal GST tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-130aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42 kDa
• AA Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PEA15 phosphoprotein enriched in astrocytes 15 [ Homo sapiens ]
• Official Symbol: PEA15
• Synonyms: PEA15; phosphoprotein enriched in astrocytes 15; astrocytic phosphoprotein PEA-15; HMAT1; homolog of mouse MAT 1 oncogene; HUMMAT1H; MAT1; MAT1H; PEA 15; PED; Phosphoprotein enriched in astrocytes; 15kD; homolog of mouse MAT-1 oncogene; phosphoprotein enriched in diabetes; Phosphoprotein enriched in astrocytes, 15kD; 15 kDa phosphoprotein enriched in astrocytes; PEA-15
• Gene ID: 8682
• mRNA Refseq: NM_003768
• Protein Refseq: NP_003759
• MIM: 603434
• UniProt ID: Q15121