Recombinant Full Length Human PGAM1 Protein, C-Flag-tagged
| Cat.No. : | PGAM1-1073HFL |
| Product Overview : | Recombinant Full Length Human PGAM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 28.6 kDa |
| AA Sequence : | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | Glycolysis / Gluconeogenesis, Metabolic pathways |
| Full Length : | Full L. |
| Gene Name | PGAM1 phosphoglycerate mutase 1 [ Homo sapiens (human) ] |
| Official Symbol | PGAM1 |
| Synonyms | PGAMA; PGAM-B; HEL-S-35 |
| Gene ID | 5223 |
| mRNA Refseq | NM_002629.4 |
| Protein Refseq | NP_002620.1 |
| MIM | 172250 |
| UniProt ID | P18669 |
| ◆ Recombinant Proteins | ||
| Pgam1-4815M | Recombinant Mouse Pgam1 Protein, Myc/DDK-tagged | +Inquiry |
| PGAM1-14M | Active Recombinant Mouse Pgam1 protein, His-tagged (Bioactivity Validated) | +Inquiry |
| PGAM1-2487TH | Recombinant Human PGAM1, GST-tagged | +Inquiry |
| PGAM1-3204R | Recombinant Rhesus Macaque PGAM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PGAM1-7027HF | Recombinant Full Length Human PGAM1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGAM1-3264HCL | Recombinant Human PGAM1 293 Cell Lysate | +Inquiry |
| PGAM1-270HKCL | Human PGAM1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGAM1 Products
Required fields are marked with *
My Review for All PGAM1 Products
Required fields are marked with *



