Recombinant Full Length Human PGAM1 Protein, C-Flag-tagged

Cat.No. : PGAM1-1073HFL
Product Overview : Recombinant Full Length Human PGAM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 28.6 kDa
AA Sequence : MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL
PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Glycolysis / Gluconeogenesis, Metabolic pathways
Full Length : Full L.
Gene Name PGAM1 phosphoglycerate mutase 1 [ Homo sapiens (human) ]
Official Symbol PGAM1
Synonyms PGAMA; PGAM-B; HEL-S-35
Gene ID 5223
mRNA Refseq NM_002629.4
Protein Refseq NP_002620.1
MIM 172250
UniProt ID P18669

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGAM1 Products

Required fields are marked with *

My Review for All PGAM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon