Recombinant Human PGAM1, GST-tagged

Cat.No. : PGAM1-2487TH
Product Overview : Recombinant Human PGAM1 (1 a.a. - 254 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Phosphoglyceric acid mutase (EC 2.7.5.3) is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway.
Molecular Mass : 53.68 kDa
Sequence : MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
Storage buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : PGAM1
Gene Name PGAM1 phosphoglycerate mutase 1 (brain) [ Homo sapiens ]
Synonyms PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; PGAM-B; phosphoglycerate mutase 1; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; Phosphoglycerate mutase A; nonmuscle form; EC 3.1.3.13; EC 5.4.2.1; EC 5.4.2.4
Gene ID 5223
mRNA Refseq NM_002629
Protein Refseq NP_002620
MIM 172250
UniProt ID P18669
Chromosome Location 10q25.3
Pathway Gluconeogenesis; Gluconeogenesis, oxaloacetate => fructose-6P; Glycine, serine and threonine metabolism
Function bisphosphoglycerate 2-phosphatase activity; bisphosphoglycerate mutase activity; hydrolase activity; isomerase activity; phosphoglycerate mutase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGAM1 Products

Required fields are marked with *

My Review for All PGAM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon