Recombinant Human PGAM1, GST-tagged
Cat.No. : | PGAM1-2487TH |
Product Overview : | Recombinant Human PGAM1 (1 a.a. - 254 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Phosphoglyceric acid mutase (EC 2.7.5.3) is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. |
Molecular Mass : | 53.68 kDa |
Sequence : | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | PGAM1 |
Gene Name | PGAM1 phosphoglycerate mutase 1 (brain) [ Homo sapiens ] |
Synonyms | PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; PGAM-B; phosphoglycerate mutase 1; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; Phosphoglycerate mutase A; nonmuscle form; EC 3.1.3.13; EC 5.4.2.1; EC 5.4.2.4 |
Gene ID | 5223 |
mRNA Refseq | NM_002629 |
Protein Refseq | NP_002620 |
MIM | 172250 |
UniProt ID | P18669 |
Chromosome Location | 10q25.3 |
Pathway | Gluconeogenesis; Gluconeogenesis, oxaloacetate => fructose-6P; Glycine, serine and threonine metabolism |
Function | bisphosphoglycerate 2-phosphatase activity; bisphosphoglycerate mutase activity; hydrolase activity; isomerase activity; phosphoglycerate mutase activity |
◆ Recombinant Proteins | ||
PGAM1-7027HF | Recombinant Full Length Human PGAM1 Protein, GST-tagged | +Inquiry |
PGAM1-4878H | Recombinant Human PGAM1 Protein (Ala2-Lys254), N-His tagged | +Inquiry |
PGAM1-2786H | Recombinant Human Phosphoglycerate Mutase 1 (Brain), His-tagged | +Inquiry |
PGAM1-1661H | Recombinant Human PGAM1 protein, His-tagged | +Inquiry |
PGAM1-13H | Active Recombinant Human PGAM1 protein, His-tagged (Bioactivity Validated) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGAM1-3264HCL | Recombinant Human PGAM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGAM1 Products
Required fields are marked with *
My Review for All PGAM1 Products
Required fields are marked with *
0
Inquiry Basket