Recombinant Human PGAM1, GST-tagged
| Cat.No. : | PGAM1-2487TH |
| Product Overview : | Recombinant Human PGAM1 (1 a.a. - 254 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Phosphoglyceric acid mutase (EC 2.7.5.3) is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. |
| Molecular Mass : | 53.68 kDa |
| Sequence : | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK |
| Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Applications : | ELISA; WB |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| OfficialSymbol : | PGAM1 |
| Gene Name | PGAM1 phosphoglycerate mutase 1 (brain) [ Homo sapiens ] |
| Synonyms | PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; PGAM-B; phosphoglycerate mutase 1; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; Phosphoglycerate mutase A; nonmuscle form; EC 3.1.3.13; EC 5.4.2.1; EC 5.4.2.4 |
| Gene ID | 5223 |
| mRNA Refseq | NM_002629 |
| Protein Refseq | NP_002620 |
| MIM | 172250 |
| UniProt ID | P18669 |
| Chromosome Location | 10q25.3 |
| Pathway | Gluconeogenesis; Gluconeogenesis, oxaloacetate => fructose-6P; Glycine, serine and threonine metabolism |
| Function | bisphosphoglycerate 2-phosphatase activity; bisphosphoglycerate mutase activity; hydrolase activity; isomerase activity; phosphoglycerate mutase activity |
| ◆ Recombinant Proteins | ||
| PGAM1-5534H | Recombinant Human PGAM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PGAM1-1661H | Recombinant Human PGAM1 protein, His-tagged | +Inquiry |
| PGAM1-14M | Active Recombinant Mouse Pgam1 protein, His-tagged (Bioactivity Validated) | +Inquiry |
| PGAM1-3199C | Recombinant Chicken PGAM1 | +Inquiry |
| Pgam1-7297M | Recombinant Mouse Pgam1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGAM1-270HKCL | Human PGAM1 Knockdown Cell Lysate | +Inquiry |
| PGAM1-3264HCL | Recombinant Human PGAM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGAM1 Products
Required fields are marked with *
My Review for All PGAM1 Products
Required fields are marked with *
