Recombinant Full Length Human PGAM5 Protein, C-Flag-tagged
Cat.No. : | PGAM5-1953HFL |
Product Overview : | Recombinant Full Length Human PGAM5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables GTPase activator activity and protein serine/threonine phosphatase activity. Involved in necroptotic process. Located in mitochondrion. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.5 kDa |
AA Sequence : | MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSL INVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGL KFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRN YIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGF MPPDKITRS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | PGAM5 PGAM family member 5, mitochondrial serine/threonine protein phosphatase [ Homo sapiens (human) ] |
Official Symbol | PGAM5 |
Synonyms | BXLBV68 |
Gene ID | 192111 |
mRNA Refseq | NM_001170543.2 |
Protein Refseq | NP_001164014 |
MIM | 614939 |
UniProt ID | Q96HS1 |
◆ Recombinant Proteins | ||
PGAM5-6659M | Recombinant Mouse PGAM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGAM5-4061R | Recombinant Rat PGAM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGAM5-3891H | Recombinant Human PGAM5 protein, His-tagged | +Inquiry |
PGAM5-1658H | Recombinant Human PGAM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGAM5-4401R | Recombinant Rat PGAM5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGAM5-3262HCL | Recombinant Human PGAM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGAM5 Products
Required fields are marked with *
My Review for All PGAM5 Products
Required fields are marked with *
0
Inquiry Basket