Recombinant Full Length Human Phosphatidylcholine:Ceramide Cholinephosphotransferase 2(Sgms2) Protein, His-Tagged
Cat.No. : | RFL14056HF |
Product Overview : | Recombinant Full Length Human Phosphatidylcholine:ceramide cholinephosphotransferase 2(SGMS2) Protein (Q8NHU3) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MDIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYI QIAMPTESRNKFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY IDRVKWAFSVSEINGIILVGLWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLP VPGMHFQCAPKLNGDSQAKVQRILRLISGGGLSITGSHILCGDFLFSGHTVTLTLTYLFI KEYSPRHFWWYHLICWLLSAAGIICILVAHEHYTIDVIIAYYITTRLFWWYHSMANEKNL KVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKKYSRVQKIGED NEKST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SGMS2 |
Synonyms | SGMS2; SMS2; Phosphatidylcholine:ceramide cholinephosphotransferase 2; Sphingomyelin synthase 2 |
UniProt ID | Q8NHU3 |
◆ Recombinant Proteins | ||
SGMS2-5178C | Recombinant Chicken SGMS2 | +Inquiry |
SGMS2-2632H | Recombinant Human SGMS2, His-tagged | +Inquiry |
SGMS2-633H | Recombinant Human SGMS2 protein(Met1-Thr79), mFc-tagged | +Inquiry |
SGMS2-15039M | Recombinant Mouse SGMS2 Protein | +Inquiry |
RFL1013RF | Recombinant Full Length Rat Phosphatidylcholine:Ceramide Cholinephosphotransferase 2(Sgms2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGMS2-593HCL | Recombinant Human SGMS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGMS2 Products
Required fields are marked with *
My Review for All SGMS2 Products
Required fields are marked with *
0
Inquiry Basket