Recombinant Full Length Human Phospholemman(Fxyd1) Protein, His-Tagged
Cat.No. : | RFL11242HF |
Product Overview : | Recombinant Full Length Human Phospholemman(FXYD1) Protein (O00168) (21-92aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (21-92) |
Form : | Lyophilized powder |
AA Sequence : | ESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FXYD1 |
Synonyms | FXYD1; PLM; Phospholemman; FXYD domain-containing ion transport regulator 1; Sodium/potassium-transporting ATPase subunit FXYD1 |
UniProt ID | O00168 |
◆ Recombinant Proteins | ||
FXYD1-8130Z | Recombinant Zebrafish FXYD1 | +Inquiry |
RFL7228CF | Recombinant Full Length Dog Phospholemman(Fxyd1) Protein, His-Tagged | +Inquiry |
FXYD1-3011H | Recombinant Human FXYD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FXYD1-6103M | Recombinant Mouse FXYD1 Protein | +Inquiry |
FXYD1-2420R | Recombinant Rat FXYD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD1-6104HCL | Recombinant Human FXYD1 293 Cell Lysate | +Inquiry |
FXYD1-6105HCL | Recombinant Human FXYD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXYD1 Products
Required fields are marked with *
My Review for All FXYD1 Products
Required fields are marked with *
0
Inquiry Basket