Recombinant Human FXYD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FXYD1-3011H |
Product Overview : | FXYD1 MS Standard C13 and N15-labeled recombinant protein (NP_005022) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The protein encoded by this gene is a plasma membrane substrate for several kinases, including protein kinase A, protein kinase C, NIMA kinase, and myotonic dystrophy kinase. It is thought to form an ion channel or regulate ion channel activity. Transcript variants with different 5' UTR sequences have been described in the literature. |
Molecular Mass : | 10.4 kDa |
AA Sequence : | MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FXYD1 FXYD domain containing ion transport regulator 1 [ Homo sapiens (human) ] |
Official Symbol | FXYD1 |
Synonyms | FXYD1; FXYD domain containing ion transport regulator 1; phospholemman, PLM; phospholemman; PLM; MGC44983; |
Gene ID | 5348 |
mRNA Refseq | NM_005031 |
Protein Refseq | NP_005022 |
MIM | 602359 |
UniProt ID | O00168 |
◆ Recombinant Proteins | ||
RFL30010RF | Recombinant Full Length Rat Phospholemman(Fxyd1) Protein, His-Tagged | +Inquiry |
FXYD1-6103M | Recombinant Mouse FXYD1 Protein | +Inquiry |
FXYD1-2996H | Recombinant Human FXYD1 protein, His-tagged | +Inquiry |
RFL7228CF | Recombinant Full Length Dog Phospholemman(Fxyd1) Protein, His-Tagged | +Inquiry |
FXYD1-8130Z | Recombinant Zebrafish FXYD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD1-6105HCL | Recombinant Human FXYD1 293 Cell Lysate | +Inquiry |
FXYD1-6104HCL | Recombinant Human FXYD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXYD1 Products
Required fields are marked with *
My Review for All FXYD1 Products
Required fields are marked with *
0
Inquiry Basket