Recombinant Full Length Human PIH1D3 Protein, GST-tagged
Cat.No. : | PIH1D3-2350HF |
Product Overview : | Human CXorf41 full-length ORF ( NP_775765.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 214 amino acids |
Description : | PIH1D3 (PIH1 Domain Containing 3) is a Protein Coding gene. Diseases associated with PIH1D3 include Primary Ciliary Dyskinesia. GO annotations related to this gene include chaperone binding. |
Molecular Mass : | 50.5 kDa |
AA Sequence : | MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDIANFF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PIH1D3 PIH1 domain containing 3 [ Homo sapiens ] |
Official Symbol | PIH1D3 |
Synonyms | CXorf41; NYSAR97; PIH1 domain containing 3; PIH1 domain containing protein 3; protein PIH1D3; sarcoma antigen NY-SAR-97; |
Gene ID | 139212 |
mRNA Refseq | NM_173494.1 |
Protein Refseq | NP_775765.1 |
MIM | 300933 |
UniProt ID | Q9NQM4 |
◆ Recombinant Proteins | ||
PIH1D3-12795M | Recombinant Mouse PIH1D3 Protein | +Inquiry |
PIH1D3-2350HF | Recombinant Full Length Human PIH1D3 Protein, GST-tagged | +Inquiry |
PIH1D3-6733M | Recombinant Mouse PIH1D3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIH1D3-458Z | Recombinant Zebrafish PIH1D3 | +Inquiry |
PIH1D3-2196H | Recombinant Human PIH1D3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIH1D3 Products
Required fields are marked with *
My Review for All PIH1D3 Products
Required fields are marked with *