Recombinant Full Length Human PIM2 Protein, C-Flag-tagged
Cat.No. : | PIM2-1388HFL |
Product Overview : | Recombinant Full Length Human PIM2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34 kDa |
AA Sequence : | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLG WSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPS RCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS RHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEI LLDPWMQTPAEDVPLNPSKGGPAPLAWSLLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Acute myeloid leukemia |
Full Length : | Full L. |
Gene Name | PIM2 Pim-2 proto-oncogene, serine/threonine kinase [ Homo sapiens (human) ] |
Official Symbol | PIM2 |
Gene ID | 11040 |
mRNA Refseq | NM_006875.4 |
Protein Refseq | NP_006866.2 |
MIM | 300295 |
UniProt ID | Q9P1W9 |
◆ Recombinant Proteins | ||
PIM2-727H | Recombinant Human Pim-2 Oncogene, GST-His | +Inquiry |
PIM2-4317H | Recombinant Human PIM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PIM2-29589TH | Recombinant Human PIM2 | +Inquiry |
Pim2-4869M | Recombinant Mouse Pim2 Protein, Myc/DDK-tagged | +Inquiry |
PIM2-1681H | Recombinant Human PIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIM2-3180HCL | Recombinant Human PIM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIM2 Products
Required fields are marked with *
My Review for All PIM2 Products
Required fields are marked with *
0
Inquiry Basket