Recombinant Full Length Human PIM2 Protein, C-Flag-tagged
| Cat.No. : | PIM2-1388HFL |
| Product Overview : | Recombinant Full Length Human PIM2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 34 kDa |
| AA Sequence : | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLG WSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPS RCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS RHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEI LLDPWMQTPAEDVPLNPSKGGPAPLAWSLLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Protein Kinase |
| Protein Pathways : | Acute myeloid leukemia |
| Full Length : | Full L. |
| Gene Name | PIM2 Pim-2 proto-oncogene, serine/threonine kinase [ Homo sapiens (human) ] |
| Official Symbol | PIM2 |
| Gene ID | 11040 |
| mRNA Refseq | NM_006875.4 |
| Protein Refseq | NP_006866.2 |
| MIM | 300295 |
| UniProt ID | Q9P1W9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIM2 Products
Required fields are marked with *
My Review for All PIM2 Products
Required fields are marked with *
