Recombinant Full Length Human PIMREG Protein, GST-tagged
| Cat.No. : | PIMREG-4626HF |
| Product Overview : | Human FAM64A full-length ORF ( AAH05004.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 248 amino acids |
| Description : | PIMREG (PICALM Interacting Mitotic Regulator) is a Protein Coding gene. Diseases associated with PIMREG include Suppurative Periapical Periodontitis. |
| Molecular Mass : | 53.9 kDa |
| AA Sequence : | MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGSGSPTHSLSQKSTRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGIQHLQKLSQELDEAIMAEERKQALSDRQGFILKDVYASP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PIMREG PICALM interacting mitotic regulator [ Homo sapiens (human) ] |
| Official Symbol | PIMREG |
| Synonyms | PIMREG; PICALM interacting mitotic regulator; PICALM Interacting Mitotic Regulator; Regulator Of Chromosome Segregation Protein 1; Family With Sequence Similarity 64 Member A; FAM64A; CALM Interacting Protein Expressed In Thymus And Spleen; CALM-Interactor Expressed In Thymus And Spleen; CATS; RCS1; Family With Sequence Similarity 64, Member A; Regulator Of Chromosome Segregation 1; Protein FAM64A; Protein PIMREG; protein PIMREG; protein FAM64A; CALM interacting protein expressed in thymus and spleen; CALM-interactor expressed in thymus and spleen; family with sequence similarity 64 member A; regulator of chromosome segregation 1; regulator of chromosome segregation protein 1 |
| Gene ID | 54478 |
| mRNA Refseq | NM_001195228 |
| Protein Refseq | NP_001182157 |
| MIM | 617611 |
| UniProt ID | Q9BSJ6 |
| ◆ Recombinant Proteins | ||
| PIMREG-1047H | Recombinant Human PIMREG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PIMREG-3788H | Recombinant Human PIMREG Protein, GST-tagged | +Inquiry |
| PIMREG-4626HF | Recombinant Full Length Human PIMREG Protein, GST-tagged | +Inquiry |
| Pimreg-409M | Recombinant Mouse Pimreg Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIMREG Products
Required fields are marked with *
My Review for All PIMREG Products
Required fields are marked with *
