Recombinant Full Length Human PIMREG Protein, GST-tagged

• Cat.No.: PIMREG-4626HF
• Product Overview: Human FAM64A full-length ORF ( AAH05004.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 248 amino acids
• Description: PIMREG (PICALM Interacting Mitotic Regulator) is a Protein Coding gene. Diseases associated with PIMREG include Suppurative Periapical Periodontitis.
• Molecular Mass: 53.9 kDa
• AA Sequence: MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGSGSPTHSLSQKSTRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGIQHLQKLSQELDEAIMAEERKQALSDRQGFILKDVYASP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PIMREG PICALM interacting mitotic regulator [ Homo sapiens (human) ]
• Official Symbol: PIMREG
• Synonyms: PIMREG; PICALM interacting mitotic regulator; PICALM Interacting Mitotic Regulator; Regulator Of Chromosome Segregation Protein 1; Family With Sequence Similarity 64 Member A; FAM64A; CALM Interacting Protein Expressed In Thymus And Spleen; CALM-Interactor Expressed In Thymus And Spleen; CATS; RCS1; Family With Sequence Similarity 64, Member A; Regulator Of Chromosome Segregation 1; Protein FAM64A; Protein PIMREG; protein PIMREG; protein FAM64A; CALM interacting protein expressed in thymus and spleen; CALM-interactor expressed in thymus and spleen; family with sequence similarity 64 member A; regulator of chromosome segregation 1; regulator of chromosome segregation protein 1
• Gene ID: 54478
• mRNA Refseq: NM_001195228
• Protein Refseq: NP_001182157
• MIM: 617611
• UniProt ID: Q9BSJ6