Recombinant Full Length Human PIMREG Protein, GST-tagged

Cat.No. : PIMREG-4626HF
Product Overview : Human FAM64A full-length ORF ( AAH05004.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 248 amino acids
Description : PIMREG (PICALM Interacting Mitotic Regulator) is a Protein Coding gene. Diseases associated with PIMREG include Suppurative Periapical Periodontitis.
Molecular Mass : 53.9 kDa
AA Sequence : MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGSGSPTHSLSQKSTRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGIQHLQKLSQELDEAIMAEERKQALSDRQGFILKDVYASP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PIMREG PICALM interacting mitotic regulator [ Homo sapiens (human) ]
Official Symbol PIMREG
Synonyms PIMREG; PICALM interacting mitotic regulator; PICALM Interacting Mitotic Regulator; Regulator Of Chromosome Segregation Protein 1; Family With Sequence Similarity 64 Member A; FAM64A; CALM Interacting Protein Expressed In Thymus And Spleen; CALM-Interactor Expressed In Thymus And Spleen; CATS; RCS1; Family With Sequence Similarity 64, Member A; Regulator Of Chromosome Segregation 1; Protein FAM64A; Protein PIMREG; protein PIMREG; protein FAM64A; CALM interacting protein expressed in thymus and spleen; CALM-interactor expressed in thymus and spleen; family with sequence similarity 64 member A; regulator of chromosome segregation 1; regulator of chromosome segregation protein 1
Gene ID 54478
mRNA Refseq NM_001195228
Protein Refseq NP_001182157
MIM 617611
UniProt ID Q9BSJ6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIMREG Products

Required fields are marked with *

My Review for All PIMREG Products

Required fields are marked with *

0
cart-icon