Recombinant Full Length Human PLA2G16 Protein, GST-tagged
| Cat.No. : | PLA2G16-3652HF |
| Product Overview : | Human HRASLS3 full-length ORF ( AAH01387, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 162 amino acids |
| Description : | PLA2G16 (Phospholipase A2 Group XVI) is a Protein Coding gene. Diseases associated with PLA2G16 include Monofixation Syndrome and Abnormal Retinal Correspondence. Among its related pathways are Linoleic acid metabolism and Regulation of lipolysis in adipocytes. GO annotations related to this gene include phospholipase A2 activity and phosphatidylserine 1-acylhydrolase activity. An important paralog of this gene is HRASLS2. |
| Molecular Mass : | 43.56 kDa |
| AA Sequence : | MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PLA2G16 phospholipase A2, group XVI [ Homo sapiens ] |
| Official Symbol | PLA2G16 |
| Synonyms | PLA2G16; phospholipase A2, group XVI; HRAS like suppressor 3 , HRASLS3; group XVI phospholipase A2; adipose specific PLA2; AdPLA; H REV107 1; HREV107; HREV107 3; MGC118754.; adipose-specific PLA2; HRAS-like suppressor 1; HRAS-like suppressor 3; H-rev 107 protein homolog; Ca-independent phospholipase A1/2; adipose-specific phospholipase A2; renal carcinoma antigen NY-REN-65; HRSL3; HRASLS3; HREV107-1; HREV107-3; H-REV107-1; MGC118754; |
| Gene ID | 11145 |
| mRNA Refseq | NM_001128203 |
| Protein Refseq | NP_001121675 |
| MIM | 613867 |
| UniProt ID | P53816 |
| ◆ Recombinant Proteins | ||
| RFL8005RF | Recombinant Full Length Rat Group Xvi Phospholipase A1/A2(Pla2G16) Protein, His-Tagged | +Inquiry |
| PLA2G16-4486R | Recombinant Rat PLA2G16 Protein | +Inquiry |
| PLA2G16-5027H | Recombinant Human PLA2G16 Protein, GST-tagged | +Inquiry |
| PLA2G16-3454R | Recombinant Rhesus monkey PLA2G16 Protein, His-tagged | +Inquiry |
| PLA2G16-6796M | Recombinant Mouse PLA2G16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLA2G16-3143HCL | Recombinant Human PLA2G16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G16 Products
Required fields are marked with *
My Review for All PLA2G16 Products
Required fields are marked with *
