Recombinant Full Length Human PLA2G16 Protein, GST-tagged

Cat.No. : PLA2G16-3652HF
Product Overview : Human HRASLS3 full-length ORF ( AAH01387, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 162 amino acids
Description : PLA2G16 (Phospholipase A2 Group XVI) is a Protein Coding gene. Diseases associated with PLA2G16 include Monofixation Syndrome and Abnormal Retinal Correspondence. Among its related pathways are Linoleic acid metabolism and Regulation of lipolysis in adipocytes. GO annotations related to this gene include phospholipase A2 activity and phosphatidylserine 1-acylhydrolase activity. An important paralog of this gene is HRASLS2.
Molecular Mass : 43.56 kDa
AA Sequence : MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PLA2G16 phospholipase A2, group XVI [ Homo sapiens ]
Official Symbol PLA2G16
Synonyms PLA2G16; phospholipase A2, group XVI; HRAS like suppressor 3 , HRASLS3; group XVI phospholipase A2; adipose specific PLA2; AdPLA; H REV107 1; HREV107; HREV107 3; MGC118754.; adipose-specific PLA2; HRAS-like suppressor 1; HRAS-like suppressor 3; H-rev 107 protein homolog; Ca-independent phospholipase A1/2; adipose-specific phospholipase A2; renal carcinoma antigen NY-REN-65; HRSL3; HRASLS3; HREV107-1; HREV107-3; H-REV107-1; MGC118754;
Gene ID 11145
mRNA Refseq NM_001128203
Protein Refseq NP_001121675
MIM 613867
UniProt ID P53816

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLA2G16 Products

Required fields are marked with *

My Review for All PLA2G16 Products

Required fields are marked with *

0
cart-icon