Recombinant Full Length Human PLCXD1 Protein, C-Flag-tagged
| Cat.No. : | PLCXD1-2096HFL |
| Product Overview : | Recombinant Full Length Human PLCXD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene is the most terminal protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alternate splicing results in multiple transcript variants. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 36.5 kDa |
| AA Sequence : | MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW LERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRR HHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRL SAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | PLCXD1 phosphatidylinositol specific phospholipase C X domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | PLCXD1 |
| Synonyms | LL0XNC01-136G2.1 |
| Gene ID | 55344 |
| mRNA Refseq | NM_018390.4 |
| Protein Refseq | NP_060860.1 |
| MIM | 300974 |
| UniProt ID | Q9NUJ7 |
| ◆ Recombinant Proteins | ||
| PLCXD1-2096HFL | Recombinant Full Length Human PLCXD1 Protein, C-Flag-tagged | +Inquiry |
| Plcxd1-4920M | Recombinant Mouse Plcxd1 Protein, Myc/DDK-tagged | +Inquiry |
| PLCXD1-3510H | Recombinant Human PLCXD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PLCXD1-1705H | Recombinant Human PLCXD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLCXD1-3849C | Recombinant Chicken PLCXD1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLCXD1-3125HCL | Recombinant Human PLCXD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLCXD1 Products
Required fields are marked with *
My Review for All PLCXD1 Products
Required fields are marked with *
