Recombinant Full Length Human PLEKHS1 Protein, GST-tagged

Cat.No. : PLEKHS1-1784HF
Product Overview : Human PLEKHS1 full-length ORF ( AAH36365, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 282 amino acids
Description : PLEKHS1 (Pleckstrin Homology Domain Containing S1) is a Protein Coding gene. Diseases associated with PLEKHS1 include Ureter, Cancer Of. An important paralog of this gene is GAB2.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 56.76 kDa
AA Sequence : MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PLEKHS1 pleckstrin homology domain containing S1 [ Homo sapiens (human) ]
Official Symbol PLEKHS1
Synonyms C10ORF81; chromosome 10 open reading frame 81; PH domain-containing protein C10orf81; bA211N11.2; FLJ23537; epididymis luminal protein 185; HEL185; RP11-211N11.2
Gene ID 79949
mRNA Refseq NM_001193434
Protein Refseq NP_001180363
UniProt ID Q5SXH7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLEKHS1 Products

Required fields are marked with *

My Review for All PLEKHS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon