Recombinant Full Length Human PNMT Protein, C-Flag-tagged
Cat.No. : | PNMT-1440HFL |
Product Overview : | Recombinant Full Length Human PNMT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 30.7 kDa |
AA Sequence : | MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV SGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECW QDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGH LLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV GLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Tyrosine metabolism |
Full Length : | Full L. |
Gene Name | PNMT phenylethanolamine N-methyltransferase [ Homo sapiens (human) ] |
Official Symbol | PNMT |
Synonyms | PENT; PNMTase |
Gene ID | 5409 |
mRNA Refseq | NM_002686.4 |
Protein Refseq | NP_002677.1 |
MIM | 171190 |
UniProt ID | P11086 |
◆ Recombinant Proteins | ||
PNMT-328H | Recombinant Human PNMT | +Inquiry |
PNMT-4549R | Recombinant Rat PNMT Protein | +Inquiry |
PNMT-6884M | Recombinant Mouse PNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
PNMT-13035M | Recombinant Mouse PNMT Protein | +Inquiry |
Pnmt-4969M | Recombinant Mouse Pnmt Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNMT-3075HCL | Recombinant Human PNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PNMT Products
Required fields are marked with *
My Review for All PNMT Products
Required fields are marked with *
0
Inquiry Basket