Recombinant Full Length Human POM121L12 Protein, GST-tagged

Cat.No. : POM121L12-3931HF
Product Overview : Human DKFZp564N2472 full-length ORF (BAC05166.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 307 amino acids
Description : POM121L12 (POM121 Transmembrane Nucleoporin Like 12) is a Protein Coding gene. An important paralog of this gene is POM121L2.
Molecular Mass : 59.4 kDa
AA Sequence : MKRPEANGPPAMGAAAPAESADLGNFWKAGEPLLQGPDALAAPMSRSPSTPQTTPSPQGRQSPWPLRSLTQSHIEYFQWGRPVPSTHLIEVRPTQDPAKPQRVVSEGWRRPALPGETALGRDLSCAWEGCMKGGLCRAWNPGRTWSPVTIGIAPPERQESPWRSPGQRARPAGRPAAQELLDPCTRETLLGALSQCPKGSARFDGPLWFEVSDSKGGRRNLQPRPSAFKPLSKNGAVASFVPRPGPLKPSLGPWSLSFCDDAWPSVLVQPAPSAIWDFWEATTPSCGSCSRVSFALEVTQSAGPFGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name POM121L12 POM121 transmembrane nucleoporin like 12 [ Homo sapiens (human) ]
Official Symbol POM121L12
Synonyms POM121L12; POM121 transmembrane nucleoporin like 12; POM121-like protein 12; POM121 membrane glycoprotein-like 12; POM121 Transmembrane Nucleoporin Like 12; POM121 Transmembrane Nucleoporin-Like 12; POM121 Membrane Glycoprotein-Like 12
Gene ID 285877
mRNA Refseq NM_182595
Protein Refseq NP_872401
UniProt ID Q8N7R1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POM121L12 Products

Required fields are marked with *

My Review for All POM121L12 Products

Required fields are marked with *

0
cart-icon