Recombinant Full Length Human POM121L12 Protein, GST-tagged
| Cat.No. : | POM121L12-3931HF |
| Product Overview : | Human DKFZp564N2472 full-length ORF (BAC05166.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 307 amino acids |
| Description : | POM121L12 (POM121 Transmembrane Nucleoporin Like 12) is a Protein Coding gene. An important paralog of this gene is POM121L2. |
| Molecular Mass : | 59.4 kDa |
| AA Sequence : | MKRPEANGPPAMGAAAPAESADLGNFWKAGEPLLQGPDALAAPMSRSPSTPQTTPSPQGRQSPWPLRSLTQSHIEYFQWGRPVPSTHLIEVRPTQDPAKPQRVVSEGWRRPALPGETALGRDLSCAWEGCMKGGLCRAWNPGRTWSPVTIGIAPPERQESPWRSPGQRARPAGRPAAQELLDPCTRETLLGALSQCPKGSARFDGPLWFEVSDSKGGRRNLQPRPSAFKPLSKNGAVASFVPRPGPLKPSLGPWSLSFCDDAWPSVLVQPAPSAIWDFWEATTPSCGSCSRVSFALEVTQSAGPFGS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | POM121L12 POM121 transmembrane nucleoporin like 12 [ Homo sapiens (human) ] |
| Official Symbol | POM121L12 |
| Synonyms | POM121L12; POM121 transmembrane nucleoporin like 12; POM121-like protein 12; POM121 membrane glycoprotein-like 12; POM121 Transmembrane Nucleoporin Like 12; POM121 Transmembrane Nucleoporin-Like 12; POM121 Membrane Glycoprotein-Like 12 |
| Gene ID | 285877 |
| mRNA Refseq | NM_182595 |
| Protein Refseq | NP_872401 |
| UniProt ID | Q8N7R1 |
| ◆ Recombinant Proteins | ||
| POM121L12-3931HF | Recombinant Full Length Human POM121L12 Protein, GST-tagged | +Inquiry |
| POM121L12-2659H | Recombinant Human POM121L12 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POM121L12 Products
Required fields are marked with *
My Review for All POM121L12 Products
Required fields are marked with *
