Recombinant Full Length Human POMP Protein, GST-tagged
Cat.No. : | POMP-1771HF |
Product Overview : | Human C13orf12 full-length ORF ( NP_057016.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 141 amino acids |
Description : | The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 42.2 kDa |
AA Sequence : | MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | POMP proteasome maturation protein [ Homo sapiens ] |
Official Symbol | POMP |
Synonyms | POMP; proteasome maturation protein; C13orf12, chromosome 13 open reading frame 12; HSPC014; proteassemblin; UMP1; hUMP1; 2510048O06Rik; protein UMP1 homolog; voltage-gated K channel beta subunit 4.1; voltage-gated potassium channel beta subunit 4.1; C13orf12; PNAS-110 |
Gene ID | 51371 |
mRNA Refseq | NM_015932 |
Protein Refseq | NP_057016 |
MIM | 613386 |
UniProt ID | Q9Y244 |
◆ Recombinant Proteins | ||
POMP-877Z | Recombinant Zebrafish POMP | +Inquiry |
POMP-6938M | Recombinant Mouse POMP Protein, His (Fc)-Avi-tagged | +Inquiry |
POMP-1771HF | Recombinant Full Length Human POMP Protein, GST-tagged | +Inquiry |
POMP-13119M | Recombinant Mouse POMP Protein | +Inquiry |
POMP-3342R | Recombinant Rhesus Macaque POMP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POMP-3017HCL | Recombinant Human POMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POMP Products
Required fields are marked with *
My Review for All POMP Products
Required fields are marked with *