Recombinant Full Length Human PON2 Protein, C-Flag-tagged
Cat.No. : | PON2-1153HFL |
Product Overview : | Recombinant Full Length Human PON2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the paraoxonase gene family, which includes three known members located adjacent to each other on the long arm of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded protein may also play a role in defense responses to pathogenic bacteria. Mutations in this gene may be associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.2 kDa |
AA Sequence : | MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDIDILPNGLAFFSVGLK FPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTV EIFKFEEAENSLLHLKTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPN EVKVVAEGFDSANGINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVYDGKLLIGTLYHRAL YCELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways |
Full Length : | Full L. |
Gene Name | PON2 paraoxonase 2 [ Homo sapiens (human) ] |
Official Symbol | PON2 |
Synonyms | A-esterase 2; aromatic esterase 2; paraoxonase 2; paraoxonase nirs; serum aryldialkylphosphatase 2; serum paraoxonase/arylesterase 2 |
Gene ID | 5445 |
mRNA Refseq | NM_000305.3 |
Protein Refseq | NP_000296.2 |
MIM | 602447 |
UniProt ID | Q15165 |
◆ Recombinant Proteins | ||
PON2-1734H | Recombinant Human PON2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PON2-30704TH | Recombinant Human PON2, His-tagged | +Inquiry |
PON2-50H | Recombinant Human Paraoxonase 2, His-tagged | +Inquiry |
PON2-4953H | Recombinant Human PON2 Protein (Ser31-Leu354), N-His tagged | +Inquiry |
Pon2-5014M | Recombinant Mouse Pon2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PON2-3013HCL | Recombinant Human PON2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PON2 Products
Required fields are marked with *
My Review for All PON2 Products
Required fields are marked with *
0
Inquiry Basket