Recombinant Full Length Human POSTN Protein, C-Flag-tagged
Cat.No. : | POSTN-677HFL |
Product Overview : | Recombinant Full Length Human POSTN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesion and migration of epithelial cells. This protein plays a role in cancer stem cell maintenance and metastasis. Mice lacking this gene exhibit cardiac valve disease, and skeletal and dental defects. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 87.1 kDa |
AA Sequence : | MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICG QKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNE AWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCAR IIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFE KLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKD IVTNNGVIHLIDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSM DQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFRE IIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQ NIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYP ADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVYRPTLTKVKIEGEPEFRLIKEGETITEVIHGE PIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGGETEETLKKLLQEDTPVRKLQANKKVQG SRRRLREGRSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | POSTN periostin [ Homo sapiens (human) ] |
Official Symbol | POSTN |
Synonyms | PN; OSF2; OSF-2; PDLPOSTN |
Gene ID | 10631 |
mRNA Refseq | NM_001135935.2 |
Protein Refseq | NP_001129407.1 |
MIM | 608777 |
UniProt ID | Q15063 |
◆ Recombinant Proteins | ||
POSTN-1736H | Recombinant Human POSTN Protein, His (Fc)-Avi-tagged | +Inquiry |
POSTN-2610H | Recombinant Human POSTN Protein, MYC/DDK-tagged | +Inquiry |
Postn-734M | Recombinant Mouse Postn Protein, 500-630 aa, His-tagged | +Inquiry |
POSTN-072H | Recombinant Human POSTN protein, His-tagged | +Inquiry |
POSTN-13HFL | Active Recombinant Full Length Human periostin Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POSTN-2756HCL | Recombinant Human POSTN cell lysate | +Inquiry |
POSTN-2269MCL | Recombinant Mouse POSTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POSTN Products
Required fields are marked with *
My Review for All POSTN Products
Required fields are marked with *
0
Inquiry Basket