Recombinant Full Length Human Potassium Channel Subfamily K Member 10(Kcnk10) Protein, His-Tagged
Cat.No. : | RFL26893HF |
Product Overview : | Recombinant Full Length Human Potassium channel subfamily K member 10(KCNK10) Protein (P57789) (1-538aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-538) |
Form : | Lyophilized powder |
AA Sequence : | MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQ GGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVS PQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFI LAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP NNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYS LDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNK10 |
Synonyms | KCNK10; TREK2; Potassium channel subfamily K member 10; Outward rectifying potassium channel protein TREK-2; TREK-2 K(+ channel subunit |
UniProt ID | P57789 |
◆ Recombinant Proteins | ||
KCNK10-2183R | Recombinant Rhesus Macaque KCNK10 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNK10-2362R | Recombinant Rhesus monkey KCNK10 Protein, His-tagged | +Inquiry |
KCNK10-261H | Recombinant Human KCNK10, His-tagged | +Inquiry |
RFL26893HF | Recombinant Full Length Human Potassium Channel Subfamily K Member 10(Kcnk10) Protein, His-Tagged | +Inquiry |
KCNK10-3207R | Recombinant Rat KCNK10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK10-5039HCL | Recombinant Human KCNK10 293 Cell Lysate | +Inquiry |
KCNK10-5038HCL | Recombinant Human KCNK10 293 Cell Lysate | +Inquiry |
KCNK10-646HCL | Recombinant Human KCNK10 Lysate | +Inquiry |
KCNK10-5040HCL | Recombinant Human KCNK10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK10 Products
Required fields are marked with *
My Review for All KCNK10 Products
Required fields are marked with *