Recombinant Full Length Human Potassium Channel Subfamily K Member 17(Kcnk17) Protein, His-Tagged
Cat.No. : | RFL11354HF |
Product Overview : | Recombinant Full Length Human Potassium channel subfamily K member 17(KCNK17) Protein (Q96T54) (1-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-332) |
Form : | Lyophilized powder |
AA Sequence : | MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKW ELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYG NLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLA GSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLW YKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPES HSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNK17 |
Synonyms | KCNK17; TALK2; TASK4; UNQ5816/PRO19634; Potassium channel subfamily K member 17; 2P domain potassium channel Talk-2; Acid-sensitive potassium channel protein TASK-4; TWIK-related acid-sensitive K(+ channel 4; TWIK-related alkaline pH-activated K(+ channel |
UniProt ID | Q96T54 |
◆ Recombinant Proteins | ||
KCNK17-356H | Recombinant Human KCNK17 Protein, MYC/DDK-tagged | +Inquiry |
RFL11354HF | Recombinant Full Length Human Potassium Channel Subfamily K Member 17(Kcnk17) Protein, His-Tagged | +Inquiry |
KCNK17-220H | Recombinant Human KCNK17 protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNK17 Products
Required fields are marked with *
My Review for All KCNK17 Products
Required fields are marked with *
0
Inquiry Basket