Recombinant Full Length Human Potassium Channel Subfamily K Member 2(Kcnk2) Protein, His-Tagged
Cat.No. : | RFL35325HF |
Product Overview : | Recombinant Full Length Human Potassium channel subfamily K member 2(KCNK2) Protein (O95069) (1-426aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-426) |
Form : | Lyophilized powder |
AA Sequence : | MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA VIENIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNK2 |
Synonyms | hTREK 1c; hTREK 1e; K2p2.1; K2P2.1 potassium channel; KCNK 2; Kcnk2; KCNK2_HUMAN; MGC126742; MGC126744; Outward rectifying potassium channel protein TREK 1; Outward rectifying potassium channel protein TREK-1; Outward rectifying potassium channel protein |
UniProt ID | O95069 |
◆ Cell & Tissue Lysates | ||
KCNK2-5036HCL | Recombinant Human KCNK2 293 Cell Lysate | +Inquiry |
KCNK2-97HCL | Recombinant Human KCNK2 Lysate | +Inquiry |
KCNK2-96HCL | Recombinant Human KCNK2 Lysate | +Inquiry |
KCNK2-5035HCL | Recombinant Human KCNK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNK2 Products
Required fields are marked with *
My Review for All KCNK2 Products
Required fields are marked with *
0
Inquiry Basket