Recombinant Full Length Human Potassium Channel Subfamily K Member 4(Kcnk4) Protein, His-Tagged
Cat.No. : | RFL2071HF |
Product Overview : | Recombinant Full Length Human Potassium channel subfamily K member 4(KCNK4) Protein (Q9NYG8) (1-393aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-393) |
Form : | Lyophilized powder |
AA Sequence : | MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGL LIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFC IFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGC LLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWIL LGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKE QPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCP LPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNK4 |
Synonyms | KCNK4; TRAAK; Potassium channel subfamily K member 4; TWIK-related arachidonic acid-stimulated potassium channel protein; Two pore potassium channel KT4.1; Two pore K(+ channel KT4.1 |
UniProt ID | Q9NYG8 |
◆ Recombinant Proteins | ||
RFL2071HF | Recombinant Full Length Human Potassium Channel Subfamily K Member 4(Kcnk4) Protein, His-Tagged | +Inquiry |
KCNK4-8533M | Recombinant Mouse KCNK4 Protein | +Inquiry |
Kcnk4-1262M | Recombinant Mouse Kcnk4 Protein, MYC/DDK-tagged | +Inquiry |
KCNK4-301374H | Recombinant Human KCNK4 protein, GST-tagged | +Inquiry |
KCNK4-4748M | Recombinant Mouse KCNK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK4-5034HCL | Recombinant Human KCNK4 293 Cell Lysate | +Inquiry |
KCNK4-323HCL | Recombinant Human KCNK4 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK4 Products
Required fields are marked with *
My Review for All KCNK4 Products
Required fields are marked with *