Recombinant Full Length Human Potassium Channel Subfamily K Member 6(Kcnk6) Protein, His-Tagged
| Cat.No. : | RFL35864HF |
| Product Overview : | Recombinant Full Length Human Potassium channel subfamily K member 6(KCNK6) Protein (Q9Y257) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-313) |
| Form : | Lyophilized powder |
| AA Sequence : | MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALD AFVERVLAAGRLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK AFSIAFALLGVPTTMLLLTASAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVV VTVCFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTV YLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQL SASSHTDYASIPR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | KCNK6 |
| Synonyms | KCNK6; TOSS; TWIK2; Potassium channel subfamily K member 6; Inward rectifying potassium channel protein TWIK-2; TWIK-originated similarity sequence |
| UniProt ID | Q9Y257 |
| ◆ Recombinant Proteins | ||
| KCNK6-909H | Recombinant Human KCNK6 protein, Myc/DDK-tagged | +Inquiry |
| Kcnk6-83M | Recombinant Mouse Kcnk6 protein, Myc/DDK-tagged | +Inquiry |
| RFL35864HF | Recombinant Full Length Human Potassium Channel Subfamily K Member 6(Kcnk6) Protein, His-Tagged | +Inquiry |
| KCNK6-5270H | Recombinant Human KCNK6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KCNK6-3214Z | Recombinant Zebrafish KCNK6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KCNK6-5032HCL | Recombinant Human KCNK6 293 Cell Lysate | +Inquiry |
| KCNK6-229HCL | Recombinant Human KCNK6 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK6 Products
Required fields are marked with *
My Review for All KCNK6 Products
Required fields are marked with *
