Recombinant Full Length Human PPARG Protein, C-Flag-tagged
Cat.No. : | PPARG-1838HFL |
Product Overview : | Recombinant Full Length Human PPARG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.4 kDa |
AA Sequence : | MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF SSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECR VCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDM NSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETD MSLHPLLQEIYKDLY myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways : | Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer |
Full Length : | Full L. |
Gene Name | PPARG peroxisome proliferator activated receptor gamma [ Homo sapiens (human) ] |
Official Symbol | PPARG |
Synonyms | GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma |
Gene ID | 5468 |
mRNA Refseq | NM_015869.5 |
Protein Refseq | NP_056953.2 |
MIM | 601487 |
UniProt ID | P37231 |
◆ Recombinant Proteins | ||
pparg-5353A | Recombinant African clawed frog pparg protein, His-tagged | +Inquiry |
PPARG-5941H | Recombinant Human PPARG Protein (Asp230-Tyr505), N-His tagged | +Inquiry |
PPARG-7880R | Recombinant Rabbit PPARG protein, His-tagged | +Inquiry |
Pparg-3362M | Recombinant Mouse Pparg protein, His-tagged | +Inquiry |
PPARG-0778H | Recombinant Human PPARG Protein (P234-Y505), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPARG-492HCL | Recombinant Human PPARG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPARG Products
Required fields are marked with *
My Review for All PPARG Products
Required fields are marked with *
0
Inquiry Basket