Recombinant Full Length Human PPIA Protein, C-Flag-tagged
Cat.No. : | PPIA-50HFL |
Product Overview : | Recombinant Full Length Human PPIA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH NGTGGKSIYGEKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE AMERFGSRNGKTSKKITIADCGQLETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PPIA peptidylprolyl isomerase A [ Homo sapiens (human) ] |
Official Symbol | PPIA |
Synonyms | CYPA; CYPH; HEL-S-69p |
Gene ID | 5478 |
mRNA Refseq | NM_021130.5 |
Protein Refseq | NP_066953.1 |
MIM | 123840 |
UniProt ID | P62937 |
◆ Recombinant Proteins | ||
PPIA-001H | Recombinant Human PPIA Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPIA-0216H | Recombinant Human PPIA Protein (M1-E165), Tag Free | +Inquiry |
Ppia-872M | Recombinant Mouse Ppia Protein | +Inquiry |
PPIA-4259R | Recombinant Rat PPIA Protein, His (Fc)-Avi-tagged | +Inquiry |
ppiA-4242E | Recombinant Escherichia coli O6:H1 ppiA protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIA-2975HCL | Recombinant Human PPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPIA Products
Required fields are marked with *
My Review for All PPIA Products
Required fields are marked with *
0
Inquiry Basket