Recombinant Full Length Human PPP1CC Protein
| Cat.No. : | PPP1CC-388HF |
| Product Overview : | Recombinant full length Human PP1C gamma with N-terminal proprietary tag.Mol Wt 61.27 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 323 amino acids |
| Description : | The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 61.270kDa inclusive of tags |
| AA Sequence : | MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCL KSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGL LCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG AMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQ AKK |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PPP1CC protein phosphatase 1, catalytic subunit, gamma isozyme [ Homo sapiens ] |
| Official Symbol | PPP1CC |
| Synonyms | PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma |
| Gene ID | 5501 |
| mRNA Refseq | NM_001244974 |
| Protein Refseq | NP_001231903 |
| MIM | 176914 |
| UniProt ID | P36873 |
| ◆ Recombinant Proteins | ||
| PPP1CC-3377R | Recombinant Rhesus Macaque PPP1CC Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ppp1cc-5056M | Recombinant Mouse Ppp1cc Protein, Myc/DDK-tagged | +Inquiry |
| PPP1CC-3004H | Recombinant Human PPP1CC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PPP1CC-1339C | Recombinant Chicken PPP1CC | +Inquiry |
| PPP1CC-2401H | Recombinant Human Protein Phosphatase 1, Catalytic Subunit, Gamma Isozyme, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP1CC-2948HCL | Recombinant Human PPP1CC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1CC Products
Required fields are marked with *
My Review for All PPP1CC Products
Required fields are marked with *
