Recombinant Full Length Human PPP2R1A Protein, C-Flag-tagged
Cat.No. : | PPP2R1A-281HFL |
Product Overview : | Recombinant Full Length Human PPP2R1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.1 kDa |
AA Sequence : | MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALA EQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDW FTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFS NLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITK TDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIM GLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMS GDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEV KPILEKLTQDQDVDVKYFAQEALTVLSLATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Phosphatase, Transcription Factors |
Protein Pathways : | Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | PPP2R1A protein phosphatase 2 scaffold subunit Aalpha [ Homo sapiens (human) ] |
Official Symbol | PPP2R1A |
Synonyms | MRD36; PP2AA; PR65A; PP2AAALPHA; PP2A-Aalpha |
Gene ID | 5518 |
mRNA Refseq | NM_014225.6 |
Protein Refseq | NP_055040.2 |
MIM | 605983 |
UniProt ID | P30153 |
◆ Recombinant Proteins | ||
PPP2R1A-281HFL | Recombinant Full Length Human PPP2R1A Protein, C-Flag-tagged | +Inquiry |
Ppp2r1a-5078M | Recombinant Full Length Mouse Ppp2r1a Protein, Myc/DDK-tagged | +Inquiry |
PPP2R1A-5964H | Recombinant Human PPP2R1A Protein (Met180-Ala589), C-His tagged | +Inquiry |
PPP2R1A-1914H | Recombinant Human PPP2R1A, GST-tagged | +Inquiry |
PPP2R1A-13251M | Recombinant Mouse PPP2R1A Protein | +Inquiry |
◆ Native Proteins | ||
PPP2R1A-30HFL | Recombinant Human PPP2R1A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R1A-2926HCL | Recombinant Human PPP2R1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP2R1A Products
Required fields are marked with *
My Review for All PPP2R1A Products
Required fields are marked with *
0
Inquiry Basket