Recombinant Full Length Human PPP2R5D Protein, C-Flag-tagged
Cat.No. : | PPP2R5D-935HFL |
Product Overview : | Recombinant Full Length Human PPP2R5D Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.8 kDa |
AA Sequence : | MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLS KIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLK FKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHL QLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQI NHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQF LEKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKA EKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLK DIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEALTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Phosphatase |
Protein Pathways : | Oocyte meiosis, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | PPP2R5D protein phosphatase 2 regulatory subunit B'delta [ Homo sapiens (human) ] |
Official Symbol | PPP2R5D |
Synonyms | B56D; MRD35; B56delta |
Gene ID | 5528 |
mRNA Refseq | NM_006245.4 |
Protein Refseq | NP_006236.1 |
MIM | 601646 |
UniProt ID | Q14738 |
◆ Recombinant Proteins | ||
PPP2R5D-1921H | Recombinant Human PPP2R5D, GST-tagged | +Inquiry |
PPP2R5D-240H | Recombinant Full Length Human PPP2R5D Protein, His-tagged | +Inquiry |
PPP2R5D-29540TH | Recombinant Human PPP2R5D, GST tagged | +Inquiry |
PPP2R5D-27639TH | Recombinant Full Length Human PPP2R5D, GST tagged | +Inquiry |
PPP2R5D-2896H | Recombinant Human PPP2R5D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R5D-2914HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
PPP2R5D-2915HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP2R5D Products
Required fields are marked with *
My Review for All PPP2R5D Products
Required fields are marked with *
0
Inquiry Basket