Recombinant Human PPP2R5D, GST tagged

Cat.No. : PPP2R5D-29540TH
Product Overview : Recombinant fragment corresponding to amino acids 514-602 of Human PPP2R5D with N terminal proprietary tag; predicted MWt 35.42 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 514-602 a.a.
Description : The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight : 35.420kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL
Gene Name PPP2R5D protein phosphatase 2, regulatory subunit B, delta [ Homo sapiens ]
Official Symbol PPP2R5D
Synonyms PPP2R5D; protein phosphatase 2, regulatory subunit B, delta; protein phosphatase 2, regulatory subunit B (B56), delta isoform , protein phosphatase 2, regulatory subunit B, delta isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
Gene ID 5528
mRNA Refseq NM_006245
Protein Refseq NP_006236
MIM 601646
Uniprot ID Q14738
Chromosome Location 6p21.1
Pathway Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Aurora B signaling, organism-specific biosystem;
Function protein binding; protein phosphatase type 2A regulator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2R5D Products

Required fields are marked with *

My Review for All PPP2R5D Products

Required fields are marked with *

0
cart-icon