Recombinant Human PPP2R5D, GST tagged
| Cat.No. : | PPP2R5D-29540TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 514-602 of Human PPP2R5D with N terminal proprietary tag; predicted MWt 35.42 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 514-602 a.a. |
| Description : | The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Molecular Weight : | 35.420kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL |
| Gene Name | PPP2R5D protein phosphatase 2, regulatory subunit B, delta [ Homo sapiens ] |
| Official Symbol | PPP2R5D |
| Synonyms | PPP2R5D; protein phosphatase 2, regulatory subunit B, delta; protein phosphatase 2, regulatory subunit B (B56), delta isoform , protein phosphatase 2, regulatory subunit B, delta isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit |
| Gene ID | 5528 |
| mRNA Refseq | NM_006245 |
| Protein Refseq | NP_006236 |
| MIM | 601646 |
| Uniprot ID | Q14738 |
| Chromosome Location | 6p21.1 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Aurora B signaling, organism-specific biosystem; |
| Function | protein binding; protein phosphatase type 2A regulator activity; |
| ◆ Recombinant Proteins | ||
| PPP2R5D-240H | Recombinant Full Length Human PPP2R5D Protein, His-tagged | +Inquiry |
| PPP2R5D-12505Z | Recombinant Zebrafish PPP2R5D | +Inquiry |
| PPP2R5D-935HFL | Recombinant Full Length Human PPP2R5D Protein, C-Flag-tagged | +Inquiry |
| PPP2R5D-1921H | Recombinant Human PPP2R5D, GST-tagged | +Inquiry |
| PPP2R5D-29540TH | Recombinant Human PPP2R5D, GST tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP2R5D-2915HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
| PPP2R5D-2914HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP2R5D Products
Required fields are marked with *
My Review for All PPP2R5D Products
Required fields are marked with *
