Recombinant Human PPP2R5D, GST tagged
Cat.No. : | PPP2R5D-29540TH |
Product Overview : | Recombinant fragment corresponding to amino acids 514-602 of Human PPP2R5D with N terminal proprietary tag; predicted MWt 35.42 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 514-602 a.a. |
Description : | The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 35.420kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL |
Gene Name | PPP2R5D protein phosphatase 2, regulatory subunit B, delta [ Homo sapiens ] |
Official Symbol | PPP2R5D |
Synonyms | PPP2R5D; protein phosphatase 2, regulatory subunit B, delta; protein phosphatase 2, regulatory subunit B (B56), delta isoform , protein phosphatase 2, regulatory subunit B, delta isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit |
Gene ID | 5528 |
mRNA Refseq | NM_006245 |
Protein Refseq | NP_006236 |
MIM | 601646 |
Uniprot ID | Q14738 |
Chromosome Location | 6p21.1 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Aurora B signaling, organism-specific biosystem; |
Function | protein binding; protein phosphatase type 2A regulator activity; |
◆ Recombinant Proteins | ||
PPP2R5D-240H | Recombinant Full Length Human PPP2R5D Protein, His-tagged | +Inquiry |
PPP2R5D-27639TH | Recombinant Full Length Human PPP2R5D, GST tagged | +Inquiry |
PPP2R5D-12505Z | Recombinant Zebrafish PPP2R5D | +Inquiry |
PPP2R5D-397HF | Recombinant Full Length Human PPP2R5D Protein | +Inquiry |
PPP2R5D-1921H | Recombinant Human PPP2R5D, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R5D-2914HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
PPP2R5D-2915HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP2R5D Products
Required fields are marked with *
My Review for All PPP2R5D Products
Required fields are marked with *
0
Inquiry Basket