Recombinant Full Length Human PPP4C Protein
Cat.No. : | PPP4C-398HF |
Product Overview : | Recombinant full length Human PPP4C with N terminal proprietary tag, 59.51kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 308 amino acids |
Description : | Serine/threonine-protein phosphatase 4 catalytic subunit is an enzyme that in humans is encoded by the PPP4C gene. |
Form : | Liquid |
Molecular Mass : | 59.510kDa inclusive of tags |
AA Sequence : | MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEES NVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFM GDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKI FCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDP EDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQ KDFIIFEAAPQETRGIPSKKPVADYFL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PPP4C protein phosphatase 4, catalytic subunit [ Homo sapiens ] |
Official Symbol | PPP4C |
Synonyms | PPP4C; protein phosphatase 4, catalytic subunit; protein phosphatase 4 (formerly X), catalytic subunit; serine/threonine-protein phosphatase 4 catalytic subunit; PP4; PPX; protein phosphatase X; catalytic subunit |
Gene ID | 5531 |
mRNA Refseq | NM_002720 |
Protein Refseq | NP_002711 |
MIM | 602035 |
UniProt ID | P60510 |
◆ Recombinant Proteins | ||
PPP4C-29539TH | Recombinant Human PPP4C | +Inquiry |
PPP4C-4643R | Recombinant Rat PPP4C Protein | +Inquiry |
PPP4C-4302R | Recombinant Rat PPP4C Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP4C-3395R | Recombinant Rhesus Macaque PPP4C Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP4C-27640TH | Recombinant Human PPP4C | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP4C-494HCL | Recombinant Human PPP4C lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP4C Products
Required fields are marked with *
My Review for All PPP4C Products
Required fields are marked with *