Recombinant Full Length Human PPP4C Protein
| Cat.No. : | PPP4C-398HF | 
| Product Overview : | Recombinant full length Human PPP4C with N terminal proprietary tag, 59.51kDa. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Protein Length : | 308 amino acids | 
| Description : | Serine/threonine-protein phosphatase 4 catalytic subunit is an enzyme that in humans is encoded by the PPP4C gene. | 
| Form : | Liquid | 
| Molecular Mass : | 59.510kDa inclusive of tags | 
| AA Sequence : | MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEES NVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFM GDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKI FCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDP EDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQ KDFIIFEAAPQETRGIPSKKPVADYFL | 
| Purity : | Proprietary Purification | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. | 
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. | 
| Gene Name | PPP4C protein phosphatase 4, catalytic subunit [ Homo sapiens ] | 
| Official Symbol | PPP4C | 
| Synonyms | PPP4C; protein phosphatase 4, catalytic subunit; protein phosphatase 4 (formerly X), catalytic subunit; serine/threonine-protein phosphatase 4 catalytic subunit; PP4; PPX; protein phosphatase X; catalytic subunit | 
| Gene ID | 5531 | 
| mRNA Refseq | NM_002720 | 
| Protein Refseq | NP_002711 | 
| MIM | 602035 | 
| UniProt ID | P60510 | 
| ◆ Recombinant Proteins | ||
| PPP4C-13271M | Recombinant Mouse PPP4C Protein | +Inquiry | 
| PPP4C-651H | Recombinant Human PPP4C Protein, His-tagged | +Inquiry | 
| PPP4C-398HF | Recombinant Full Length Human PPP4C Protein | +Inquiry | 
| PPP4C-2288H | Recombinant Human PPP4C, His-tagged | +Inquiry | 
| PPP4C-7599H | Recombinant Human PPP4C protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PPP4C-494HCL | Recombinant Human PPP4C lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All PPP4C Products
Required fields are marked with *
My Review for All PPP4C Products
Required fields are marked with *
  
        
    
      
            