Recombinant Full Length Human PPP6C Protein
Cat.No. : | PPP6C-400HF |
Product Overview : | Recombinant full length Human PPP6C with N terminal proprietary tag; Predicted MW 59.29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 305 amino acids |
Description : | This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X. |
Form : | Liquid |
Molecular Mass : | 59.290kDa inclusive of tags |
AA Sequence : | MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESN VQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMG DFVDSGYYSLETFTYLLALKAKWPDRITLLRGNHESRQIT QVYGFYDECQTKYGNANAWRYCTKVLDMLTVAALIDEQIL CVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPE DVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLV HEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTR EPKLFRAVPDSERVIPPRTTTPYFL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PPP6C protein phosphatase 6, catalytic subunit [ Homo sapiens ] |
Official Symbol | PPP6C |
Synonyms | PPP6C; protein phosphatase 6, catalytic subunit; serine/threonine-protein phosphatase 6 catalytic subunit; PP6 |
Gene ID | 5537 |
mRNA Refseq | NM_001123355 |
Protein Refseq | NP_001116827 |
MIM | 612725 |
UniProt ID | O00743 |
◆ Recombinant Proteins | ||
PPP6C-13276M | Recombinant Mouse PPP6C Protein | +Inquiry |
PPP6C-1928H | Recombinant Human PPP6C, His-tagged | +Inquiry |
PPP6C-3597C | Recombinant Chicken PPP6C | +Inquiry |
PPP6C-29541TH | Recombinant Human PPP6C | +Inquiry |
PPP6C-4305R | Recombinant Rat PPP6C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP6C-1407HCL | Recombinant Human PPP6C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP6C Products
Required fields are marked with *
My Review for All PPP6C Products
Required fields are marked with *