Recombinant Full Length Human Pq-Loop Repeat-Containing Protein 3(Pqlc3) Protein, His-Tagged
Cat.No. : | RFL21663HF |
Product Overview : | Recombinant Full Length Human PQ-loop repeat-containing protein 3(PQLC3) Protein (Q8N755) (20-202aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-202) |
Form : | Lyophilized powder |
AA Sequence : | LKLPQISAVLAARSARGLSLPSLLLELAGFLVFLRYQCYYGYPPLTYLEYPILIAQDVIL LLCIFHFNGNVKQATPYIAVLVSSWFILALQKWIIDLAMNLCTFISAASKFAQLQCLWKT RDSGTVSALTWSLSSYTCATRIITTLMTTNDFTILLRFVIMLALNIWVTVTVLRYRKTAI KAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PQLC3 |
Synonyms | SLC66A3; C2orf22; PQLC3; Solute carrier family 66 member 3; PQ-loop repeat-containing protein 3 |
UniProt ID | Q8N755 |
◆ Recombinant Proteins | ||
RFL21663HF | Recombinant Full Length Human Pq-Loop Repeat-Containing Protein 3(Pqlc3) Protein, His-Tagged | +Inquiry |
PQLC3-1334Z | Recombinant Zebrafish PQLC3 | +Inquiry |
RFL22238MF | Recombinant Full Length Mouse Pq-Loop Repeat-Containing Protein 3(Pqlc3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PQLC3-496HCL | Recombinant Human PQLC3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PQLC3 Products
Required fields are marked with *
My Review for All PQLC3 Products
Required fields are marked with *