Recombinant Full Length Human PRDM12 Protein, C-Flag-tagged
| Cat.No. : | PRDM12-802HFL |
| Product Overview : | Recombinant Full Length Human PRDM12 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a transcriptional regulator of sensory neuronal specification that plays a critical role in pain perception. The encoded protein contains an N-terminal PRDI-BF1 and RIZ homology (PR) domain, a SET domain, and three C-terminal C2H2 zinc finger DNA-binding domains. Naturally occurring mutations in this gene are associated with congenital insensitivity to pain (CIP), and hereditary sensory and autonomic neuropathies (HSAN's) affecting peripheral sensory and autonomic neurons. Deregulation of this gene is associated with solid cancers and hematological malignancies including chronic myeloid leukaemia. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 40.2 kDa |
| AA Sequence : | MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLFEDKSHHASPKTAFTAEVLAQ SFSGEVQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVF NEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL GIPGVPGLEEDQKKNKHEDFHPADSAAGPAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRF SQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAA AAAAAAAAAHHLPAMVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | PRDM12 PR/SET domain 12 [ Homo sapiens (human) ] |
| Official Symbol | PRDM12 |
| Synonyms | PFM9; HSAN8 |
| Gene ID | 59335 |
| mRNA Refseq | NM_021619.3 |
| Protein Refseq | NP_067632.2 |
| MIM | 616458 |
| UniProt ID | Q9H4Q4 |
| ◆ Recombinant Proteins | ||
| PRDM12-2914H | Recombinant Human PRDM12 Protein, MYC/DDK-tagged | +Inquiry |
| PRDM12-7064M | Recombinant Mouse PRDM12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRDM12-1756H | Recombinant Human PRDM12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRDM12-802HFL | Recombinant Full Length Human PRDM12 Protein, C-Flag-tagged | +Inquiry |
| Prdm12-5099M | Recombinant Mouse Prdm12 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDM12 Products
Required fields are marked with *
My Review for All PRDM12 Products
Required fields are marked with *
