Recombinant Full Length Human PRDX4 Protein, C-Flag-tagged
Cat.No. : | PRDX4-2119HFL |
Product Overview : | Recombinant Full Length Human PRDX4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 30.4 kDa |
AA Sequence : | MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVA DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRS INTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGI LRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PRDX4 peroxiredoxin 4 [ Homo sapiens (human) ] |
Official Symbol | PRDX4 |
Synonyms | PRX-4; AOE372; AOE37-2; HEL-S-97n |
Gene ID | 10549 |
mRNA Refseq | NM_006406.2 |
Protein Refseq | NP_006397.1 |
MIM | 300927 |
UniProt ID | Q13162 |
◆ Recombinant Proteins | ||
PRDX4-2845H | Recombinant Human PRDX4 protein(71-260 aa), C-His-tagged | +Inquiry |
PRDX4-4660R | Recombinant Rat PRDX4 Protein | +Inquiry |
PRDX4-3910H | Recombinant Human PRDX4 Protein (Trp38-Asn271), N-His tagged | +Inquiry |
PRDX4-13325M | Recombinant Mouse PRDX4 Protein | +Inquiry |
PRDX4-30466TH | Recombinant Human PRDX4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX4-2880HCL | Recombinant Human PRDX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRDX4 Products
Required fields are marked with *
My Review for All PRDX4 Products
Required fields are marked with *
0
Inquiry Basket