Recombinant Full Length Human PRKAB1 Protein, tagged

• Cat.No.: PRKAB1-10HFL
• Product Overview: Recombinant protein of human protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1) with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 1-270 aa
• Description: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 30.2 kDa
• AASequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method
• Shipping: Dry Ice

Gene Information

• Gene Name: PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit [ Homo sapiens (human) ]
• Official Symbol: PRKAB1
• Synonyms: PRKAB1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit beta-1; AMPK beta 1; AMPKb; AMPK beta -1 chain; AMPK subunit beta-1; AMP-activated protein kinase beta subunit; 5-AMP-activated protein kinase beta-1 subunit; protein kinase, AMP-activated, noncatalytic, beta-1; AMPK; HAMPKb; MGC17785
• Gene ID: 5564
• mRNA Refseq: NM_006253
• Protein Refseq: NP_006244
• MIM: 602740
• UniProt ID: Q9Y478