Recombinant Full Length Human Probable Low Affinity Copper Uptake Protein 2(Slc31A2) Protein, His-Tagged
Cat.No. : | RFL27103HF |
Product Overview : | Recombinant Full Length Human Probable low affinity copper uptake protein 2(SLC31A2) Protein (O15432) (1-143aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-143) |
Form : | Lyophilized powder |
AA Sequence : | MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPT SISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTW IFLGVVLGSAVGYYLAYPLLSTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC31A2 |
Synonyms | SLC31A2; COPT2; CTR2; Probable low affinity copper uptake protein 2; Copper transporter 2; hCTR2; Solute carrier family 31 member 2 |
UniProt ID | O15432 |
◆ Recombinant Proteins | ||
RFL27103HF | Recombinant Full Length Human Probable Low Affinity Copper Uptake Protein 2(Slc31A2) Protein, His-Tagged | +Inquiry |
SLC31A2-2750H | Recombinant Human SLC31A2, GST-tagged | +Inquiry |
SLC31A2-7838Z | Recombinant Zebrafish SLC31A2 | +Inquiry |
RFL10780MF | Recombinant Full Length Mouse Probable Low Affinity Copper Uptake Protein 2(Slc31A2) Protein, His-Tagged | +Inquiry |
SLC31A2-5060C | Recombinant Chicken SLC31A2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC31A2 Products
Required fields are marked with *
My Review for All SLC31A2 Products
Required fields are marked with *
0
Inquiry Basket