Recombinant Full Length Human Progestin And Adipoq Receptor Family Member 4(Paqr4) Protein, His-Tagged
Cat.No. : | RFL16721HF |
Product Overview : | Recombinant Full Length Human Progestin and adipoQ receptor family member 4(PAQR4) Protein (Q8N4S7) (1-273aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-273) |
Form : | Lyophilized powder |
AA Sequence : | MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALL GFLVLVPMTMPWGQLGKDGWLGGTHCVACLAPPAGSVLYHLFMCHQGGSAVYARLLALDM CGVCLVNTLGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQ AAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSH QIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAQR4 |
Synonyms | PAQR4; Progestin and adipoQ receptor family member 4; Progestin and adipoQ receptor family member IV |
UniProt ID | Q8N4S7 |
◆ Recombinant Proteins | ||
PAQR4-3301R | Recombinant Rhesus monkey PAQR4 Protein, His-tagged | +Inquiry |
PAQR4-3119R | Recombinant Rhesus Macaque PAQR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAQR4-3792H | Recombinant Human PAQR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35500MF | Recombinant Full Length Mouse Progestin And Adipoq Receptor Family Member 4(Paqr4) Protein, His-Tagged | +Inquiry |
PAQR4-12350M | Recombinant Mouse PAQR4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAQR4-3439HCL | Recombinant Human PAQR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAQR4 Products
Required fields are marked with *
My Review for All PAQR4 Products
Required fields are marked with *