Recombinant Full Length Human PROP1 Protein, C-Flag-tagged
Cat.No. : | PROP1-510HFL |
Product Overview : | Recombinant Full Length Human PROP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a paired-like homeodomain transcription factor in the developing pituitary gland. Expression occurs prior to and is required for expression of pou domain transcription factor 1, which is responsible for pituitary development and hormone expression. Mutations in this gene have been associated with combined pituitary hormone deficiency-2 as well as deficiencies in luteinizing hormone, follicle-stimulating hormone, growth hormone, prolactin, and thyroid-stimulating hormone. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.8 kDa |
AA Sequence : | MEAERRRQAEKPKKGRVGSSLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQGGQRGRPHSRR RHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSP AAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPSTGGAFALSHQSEDWYPTLHPAPAGHLPCPP PPPMLPLSLEPSKSWNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | PROP1 PROP paired-like homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | PROP1 |
Synonyms | CPHD2; PROP-1 |
Gene ID | 5626 |
mRNA Refseq | NM_006261.5 |
Protein Refseq | NP_006252.4 |
MIM | 601538 |
UniProt ID | O75360 |
◆ Recombinant Proteins | ||
Prop1-5142M | Recombinant Mouse Prop1 Protein, Myc/DDK-tagged | +Inquiry |
PROP1-510HFL | Recombinant Full Length Human PROP1 Protein, C-Flag-tagged | +Inquiry |
PROP1-13437M | Recombinant Mouse PROP1 Protein | +Inquiry |
PROP1-7136M | Recombinant Mouse PROP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PROP1-1774H | Recombinant Human PROP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROP1-2832HCL | Recombinant Human PROP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PROP1 Products
Required fields are marked with *
My Review for All PROP1 Products
Required fields are marked with *
0
Inquiry Basket