Recombinant Full Length Human Protein Cornichon Homolog(Cnih) Protein, His-Tagged
Cat.No. : | RFL18085HF |
Product Overview : | Recombinant Full Length Human Protein cornichon homolog(CNIH) Protein (O95406) (1-144aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-144) |
Form : | Lyophilized powder |
AA Sequence : | MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHA FFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGW CKLAFYLLAFFYYLYGMIYVLVSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNIH1 |
Synonyms | CNIH1; CNIH; CNIL; UNQ155/PRO181; Protein cornichon homolog 1; CNIH-1; Cornichon family AMPA receptor auxiliary protein 1; Protein cornichon homolog; T-cell growth-associated molecule 77; TGAM77 |
UniProt ID | O95406 |
◆ Recombinant Proteins | ||
CNIH1-162C | Recombinant Cynomolgus Monkey CNIH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30207BF | Recombinant Full Length Bovine Protein Cornichon Homolog(Cnih) Protein, His-Tagged | +Inquiry |
CNIH1-3259C | Recombinant Chicken CNIH1 | +Inquiry |
RFL18085HF | Recombinant Full Length Human Protein Cornichon Homolog(Cnih) Protein, His-Tagged | +Inquiry |
CNIH1-414C | Recombinant Cynomolgus CNIH1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNIH1 Products
Required fields are marked with *
My Review for All CNIH1 Products
Required fields are marked with *