Recombinant Full Length Human Protein Orai-2(Orai2) Protein, His-Tagged
Cat.No. : | RFL20825HF |
Product Overview : | Recombinant Full Length Human Protein orai-2(ORAI2) Protein (Q96SN7) (1-254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-254) |
Form : | Lyophilized powder |
AA Sequence : | MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAKL KASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTCILP NVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARR QPGPPPGPGSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIEELHKL KVQLDGHERSLQVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORAI2 |
Synonyms | ORAI2; C7orf19; CBCIP2; TMEM142B; PP1729; Protein orai-2; CAP-binding protein complex-interacting protein 2; Transmembrane protein 142B |
UniProt ID | Q96SN7 |
◆ Recombinant Proteins | ||
ORAI2-3060R | Recombinant Rhesus Macaque ORAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20825HF | Recombinant Full Length Human Protein Orai-2(Orai2) Protein, His-Tagged | +Inquiry |
ORAI2-7622Z | Recombinant Zebrafish ORAI2 | +Inquiry |
RFL23203XF | Recombinant Full Length Xenopus Laevis Protein Orai-2(Orai2) Protein, His-Tagged | +Inquiry |
ORAI2-2412C | Recombinant Chicken ORAI2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ORAI2-3554HCL | Recombinant Human ORAI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ORAI2 Products
Required fields are marked with *
My Review for All ORAI2 Products
Required fields are marked with *