Recombinant Full Length Human Protein Yipf7(Yipf7) Protein, His-Tagged
Cat.No. : | RFL35433HF |
Product Overview : | Recombinant Full Length Human Protein YIPF7(YIPF7) Protein (Q8N8F6) (1-280aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-280) |
Form : | Lyophilized powder |
AA Sequence : | MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYG SRKQQAGEQPQPASFVPSEMLMSSGYAGQFFQPASNSDYYSQSPYIDSFDEEPPLLEELG IHFDHIWQKTLTVLNPMKPVDGSIMNETDLTGPILFCVALGATLLLAGKVQFGYVYGMSA IGCLVIHALLNLMSSSGVSYGCVASVLGYCLLPMVILSGCAMFFSLQGIFGIMSSLVIIG WCSLSASKIFIAALHMEGQQLLVAYPCAILYGLFALLTIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YIPF7 |
Synonyms | YIPF7; FINGER9; YIP1B; Protein YIPF7; Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9; YIP1 family member 7 |
UniProt ID | Q8N8F6 |
◆ Recombinant Proteins | ||
YIPF7-10260M | Recombinant Mouse YIPF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
YIPF7-18665M | Recombinant Mouse YIPF7 Protein | +Inquiry |
RFL5811BF | Recombinant Full Length Bovine Protein Yipf7(Yipf7) Protein, His-Tagged | +Inquiry |
RFL35433HF | Recombinant Full Length Human Protein Yipf7(Yipf7) Protein, His-Tagged | +Inquiry |
RFL7724MF | Recombinant Full Length Mouse Protein Yipf7(Yipf7) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YIPF7 Products
Required fields are marked with *
My Review for All YIPF7 Products
Required fields are marked with *