Recombinant Full Length Human Proteinase-Activated Receptor 4(F2Rl3) Protein, His-Tagged
Cat.No. : | RFL6322HF |
Product Overview : | Recombinant Full Length Human Proteinase-activated receptor 4(F2RL3) Protein (Q96RI0) (48-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (48-385) |
Form : | Lyophilized powder |
AA Sequence : | GYPGQVCANDSDTLELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAP RLPSTMLLMNLAAADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLL AAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVL CHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAV VLASAVAFFVPSNLLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEF RDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F2RL3 |
Synonyms | F2RL3; PAR4; Proteinase-activated receptor 4; PAR-4; Coagulation factor II receptor-like 3; Thrombin receptor-like 3 |
UniProt ID | Q96RI0 |
◆ Recombinant Proteins | ||
F2RL3-29834H | Active Recombinant Human CX3CR1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
F2rl3-998M | Recombinant Mouse F2rl3 Protein, MYC/DDK-tagged | +Inquiry |
F2RL3-1836R | Recombinant Rat F2RL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
F2RL3-2752H | Recombinant Human F2RL3 protein, His-tagged | +Inquiry |
RFL13537RF | Recombinant Full Length Rat Proteinase-Activated Receptor 4(F2Rl3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F2RL3-6483HCL | Recombinant Human F2RL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F2RL3 Products
Required fields are marked with *
My Review for All F2RL3 Products
Required fields are marked with *