Recombinant Human F2RL3 protein, His-tagged
Cat.No. : | F2RL3-2752H |
Product Overview : | Recombinant Human F2RL3 protein(305-385 aa), fused to His tag, was expressed in E. coli. |
Availability | July 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 305-385 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | F2RL3 coagulation factor II (thrombin) receptor-like 3 [ Homo sapiens ] |
Official Symbol | F2RL3 |
Synonyms | F2RL3; coagulation factor II (thrombin) receptor-like 3; proteinase-activated receptor 4; PAR4; proteinase activated receptor 4; PAR-4; thrombin receptor-like 3; protease-activated receptor-4; proteinase-activated receptor-4; coagulation factor II receptor-like 3; |
Gene ID | 9002 |
mRNA Refseq | NM_003950 |
Protein Refseq | NP_003941 |
MIM | 602779 |
UniProt ID | Q96RI0 |
◆ Recombinant Proteins | ||
F2RL3-2179R | Recombinant Rat F2RL3 Protein | +Inquiry |
F2RL3-5412M | Recombinant Mouse F2RL3 Protein | +Inquiry |
F2RL3-1836R | Recombinant Rat F2RL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
F2RL3-2920M | Recombinant Mouse F2RL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
F2RL3-3231H | Recombinant Human F2RL3 Protein (Gly48-Gln385), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F2RL3-6483HCL | Recombinant Human F2RL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F2RL3 Products
Required fields are marked with *
My Review for All F2RL3 Products
Required fields are marked with *