Recombinant Human F2RL3 protein, His-tagged

• Cat.No.: F2RL3-2752H
• Product Overview: Recombinant Human F2RL3 protein(305-385 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 305-385 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: LHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: F2RL3 coagulation factor II (thrombin) receptor-like 3 [ Homo sapiens ]
• Official Symbol: F2RL3
• Synonyms: F2RL3; coagulation factor II (thrombin) receptor-like 3; proteinase-activated receptor 4; PAR4; proteinase activated receptor 4; PAR-4; thrombin receptor-like 3; protease-activated receptor-4; proteinase-activated receptor-4; coagulation factor II receptor-like 3
• Gene ID: 9002
• mRNA Refseq: NM_003950
• Protein Refseq: NP_003941
• MIM: 602779
• UniProt ID: Q96RI0