Recombinant Full Length Human PRR23C Protein, GST-tagged

• Cat.No.: PRR23C-4940HF
• Product Overview: Human FLJ46210 full-length ORF (BAC87269.1, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 262 amino acids
• Description: PRR23C (Proline Rich 23C) is a Protein Coding gene. An important paralog of this gene is PRR23B.
• Molecular Mass: 54.2 kDa
• AA Sequence: MGSRPCSPSACLAPWWGQQPGGPGPAKRSRLEEPAGPESRAAPSPEDPAGTPAVDALTSMVVLDAGCALRVPLEDVDLVLELAPMSVLRVSLGGHTLIVIPEVLLSSVDECSGAQGDWSAGLEVDVFLGAHGEDVVVEQEVCASVPEIAAEEEAYEEDADSEFPELWMDSAAGSAAGLYPSARSMFSPYREGPIRGPCALAPNPSSERRSPRPIFDLEFHLLEPVPSSPLQPLPPSPSPGPHARPELPERPPCKVRRRLFQE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PRR23C proline rich 23C [ Homo sapiens (human) ]
• Official Symbol: PRR23C
• Synonyms: PRR23C; proline rich 23C; proline-rich protein 23C; proline-rich protein 23A
• Gene ID: 389152
• mRNA Refseq: NM_001134657
• Protein Refseq: NP_001128129
• UniProt ID: Q6ZRP0