Recombinant Full Length Human PRR23C Protein, GST-tagged
Cat.No. : | PRR23C-4940HF |
Product Overview : | Human FLJ46210 full-length ORF (BAC87269.1, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 262 amino acids |
Description : | PRR23C (Proline Rich 23C) is a Protein Coding gene. An important paralog of this gene is PRR23B. |
Molecular Mass : | 54.2 kDa |
AA Sequence : | MGSRPCSPSACLAPWWGQQPGGPGPAKRSRLEEPAGPESRAAPSPEDPAGTPAVDALTSMVVLDAGCALRVPLEDVDLVLELAPMSVLRVSLGGHTLIVIPEVLLSSVDECSGAQGDWSAGLEVDVFLGAHGEDVVVEQEVCASVPEIAAEEEAYEEDADSEFPELWMDSAAGSAAGLYPSARSMFSPYREGPIRGPCALAPNPSSERRSPRPIFDLEFHLLEPVPSSPLQPLPPSPSPGPHARPELPERPPCKVRRRLFQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PRR23C proline rich 23C [ Homo sapiens (human) ] |
Official Symbol | PRR23C |
Synonyms | PRR23C; proline rich 23C; proline-rich protein 23C; proline-rich protein 23A |
Gene ID | 389152 |
mRNA Refseq | NM_001134657 |
Protein Refseq | NP_001128129 |
UniProt ID | Q6ZRP0 |
◆ Recombinant Proteins | ||
PRR23C-4940HF | Recombinant Full Length Human PRR23C Protein, GST-tagged | +Inquiry |
PRR23C-4353H | Recombinant Human PRR23C Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRR23C Products
Required fields are marked with *
My Review for All PRR23C Products
Required fields are marked with *
0
Inquiry Basket