Recombinant Full Length Human PRR4 Protein, C-Flag-tagged
Cat.No. : | PRR4-1255HFL |
Product Overview : | Recombinant Full Length Human PRR4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the proline-rich protein family that lacks a conserved repetitive domain. This protein may play a role in protective functions in the eye. Alternative splicing result in multiple transcript variants. Read-through transcription also exists between this gene and the upstream PRH1 (proline-rich protein HaeIII subfamily 1) gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQ QRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEASSFFRRDRPARHPQEQPLWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | PRR4 proline rich 4 [ Homo sapiens (human) ] |
Official Symbol | PRR4 |
Synonyms | LPRP; PROL4 |
Gene ID | 11272 |
mRNA Refseq | NM_007244.3 |
Protein Refseq | NP_009175.2 |
MIM | 605359 |
UniProt ID | Q16378 |
◆ Recombinant Proteins | ||
PRR4-750H | Recombinant Human PRR4 | +Inquiry |
PRR4-1255HFL | Recombinant Full Length Human PRR4 Protein, C-Flag-tagged | +Inquiry |
PRR4-1986H | Recombinant Human PRR4 Protein, His&GST-tagged | +Inquiry |
PRR4-4255H | Recombinant Human PRR4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRR4-1778H | Recombinant Human PRR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRR4 Products
Required fields are marked with *
My Review for All PRR4 Products
Required fields are marked with *